Volver

CCL16 LEC/NCC-4 Human Recombinant Protein

Supplier: Boster
Reference: PROTO15467
Name: CCL16 LEC/NCC-4 Human Recombinant Protein
Category: Protein
Subcategory: Recombinant Proteins
Aditional Names: C-C motif chemokine 16; Small-inducible cytokine A16; IL-10-inducible chemokine; Chemokine LEC; Monotactin-1; Chemokine CC-4; Lymphocyte and monocyte chemoattractant; CCL-16; HCC-4; HCC4; NCC4; NCC-4; Liver Expressed Chemokine; LMC; LCC-1; LCC1; MTN-1; MTN1; SCYL4; ckB12; SCYA16; LEC; ILINCK; MGC117051
Unit: 5ug 20ug 1mg
Price: Consultar
Format: Sterile Filtered White lyophilized (freeze-dried) powder.
Reactivity: Human
Description: CCL16 Human Recombinant produced in E. coli is a non-glycosylated, Polypeptide chain containing 97 amino acids and having a molecular mass of 11.2 kDa. The CCL16 is purified by proprietary chromatographic techniques.
Function: Shows chemotactic activity for lymphocytes and monocytes but not neutrophils. Also shows potent myelosuppressive activity, suppresses proliferation of myeloid progenitor cells. Recombinant SCYA16 shows chemotactic activity for monocytes and THP-1 monocyt
Cell localization: Secreted.
Purification: Greater than 97.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.
Storage conditions: Lyophilized CCL16 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL16 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a
Aa sequence: QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNP NDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
Solicitar hoja técnica Contacto