Volver

IL17F Interleukin-17F Mouse Recombinant Protein

Supplier: Boster
Reference: PROTQ7TNI7
Name: IL17F Interleukin-17F Mouse Recombinant Protein
Category: Protein
Subcategory: Recombinant Proteins
Aditional Names: Cytokine ML-1; IL-17F; Interleukin-17F precursor; IL17F; ML1; ML-1
Unit: 5ug 25ug 1mg
Price: Consultar
Format: Sterile Filtered White lyophilized (freeze-dried) powder.
Reactivity: Mouse
Description: IL17F Mouse Recombinant produced in E. coli is a homodimeric, non-glycosylated polypeptide chain containing a total of 266 amino acids and having a molecular mass of 29.8 kDa. The Mouse IL-17F is purified by proprietary chromatographic techniques.
Function: Stimulates the production of other cytokines such as IL- 6, IL-8 and granulocyte colony-stimulating factor, and can regulate cartilage matrix turnover. Stimulates PBMC and T-cell proliferation. Inhibits angiogenesis. Plays a role in the induction of neut
Cell localization: Secreted
Purification: Greater than 97.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.
Storage conditions: Lyophilized Murine IL17F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17F should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to
Aa sequence: RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSP WDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRR EPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA
Solicitar hoja técnica Contacto