MOG Myelin Oligodendrocyte Glycoprotein Human Recombinant Protein

Supplier: Boster
Reference: PROTQ16653
Name: MOG Myelin Oligodendrocyte Glycoprotein Human Recombinant Protein
Category: Protein
Subcategory: Recombinant Proteins
Aditional Names: Myelin Oligodendrocyte Glycoprotein; MOG; MOGIG-2; MGC26137
Unit: 10ug 50ug 1mg
Price: Consultar
Format: Sterile Filtered White lyophilized (freeze-dried) powder.
Description: Myelin Oligodendrocyte Glycoprotein produced in E. coli is a single, non-glycosylated polypeptide chain containing a total of 132 amino acids (Met + 30-154 a.a. + 6x His tag at C-terminus) and having a total molecular mass of 15.2 kDa.
Function: Mediates homophilic cell-cell adhesion (By similarity). Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell- cell communication.
Cell localization: Isoform 1: Cell membrane
Purification: Greater than 95.0% as determined by SDS-PAGE.
Storage conditions: Lyophilized MOG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MOG should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a car
Aa sequence: MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRN GKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQE EAAMELKVEDPFYWVSPGHHHHHH