BMP-7 Bone Morphogenetic Protein-7 Human Recombinant Protein, Plant

Supplier: Boster
Reference: PROTP18075
Name: BMP-7 Bone Morphogenetic Protein-7 Human Recombinant Protein, Plant
Category: Protein
Subcategory: Recombinant Proteins
Aditional Names: Osteogenic Protein 1; BMP-7
Unit: 2ug 10ug 1mg
Price: Consultar
Format: Sterile Filtered White lyophilized (freeze-dried) powder.
Reactivity: Human
Description: Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus. The BMP-7 is purified by propri
Function: Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis.
Cell localization: Secreted.
Purification: Greater than 97.0% as determined by SDS-PAGE.
Storage conditions: Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP 7 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to
Aa sequence: HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAEN SSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAY YCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKP CCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH