Volver

NRG1 Heregulin-B2 Human Recombinant Protein

Supplier: Boster
Reference: PROTQ02297
Name: NRG1 Heregulin-B2 Human Recombinant Protein
Category: Protein
Subcategory: Recombinant Proteins
Aditional Names: Neuregulin-1; NRG1; GGF; HGL; HRGA; NDF; SMDF; HRG; ARIA; GGF2; HRG1
Unit: 10ug 50ug 1mg
Price: Consultar
Format: Sterile Filtered White lyophilized (freeze-dried) powder.
Reactivity: Human
Description: Recombinant Human Neuregulin-1 beta 2 produced in E. coli is a single, non-glycosylated, polypeptide chain containing 61 amino acids and having a total molecular mass of 7.0kDa. NRG-1 is purified by proprietary chromatographic techniques.
Function: Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. The multiple isoforms perform diverse functions
Cell localization: Pro-neuregulin-1, membrane-bound isoform: Cell membrane; Single-pass type I membrane protein. Does not seem to be active.
Purification: Greater than 96.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.
Storage conditions: Lyophilized NRG1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Heregulin should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.
Aa sequence: SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ
Solicitar hoja técnica Contacto