SPP1 Human, Osteopontin Human Recombinant Protein, HEK

Supplier: Boster
Reference: PROTP10451
Name: SPP1 Human, Osteopontin Human Recombinant Protein, HEK
Category: Protein
Subcategory: Recombinant Proteins
Aditional Names: Secreted Phosphoprotein-1; OPN; BNSP; BSPI; ETA-1; MGC110940; SPP-1; Osteopontin; Bone sialoprotein 1; Urinary stone protein; Nephropontin; Uropontin; SPP1
Unit: 10ug 50ug 1mg
Price: Consultar
Format: Sterile Filtered White lyophilized (freeze-dried) powder.
Reactivity: Human
Description: Osteopontin Human Recombinant is a single, glycosylated, polypeptide chain produced in HEK293 cells, is a full length protein (amino acids 17-314) fused with a polyhistidine tag at the C-terminus, having a total calculated molecular mass of 34.5kDa (The a
Function: Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction.
Cell localization: Secreted.
Purification: Greater than 95.0% as determined by SDS-PAGE.
Storage conditions: Store at 4°C if entire vial will be used within 2-4 weeks. Store frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.
Aa sequence: IPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETL PSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDEL VTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDATDEDIT SHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRK ANDESNEHSDVIDSQELS