Recombinant Hirudin

Supplier: Signalway
Reference: AP60500
Name: Recombinant Hirudin
Category: Protein
Subcategory: Proteins with activity
Unit: 10ug 100ug
Price: Consultar
Format: Lyophilized from a 0.2 ?m filtered solution of 20 mM PB, pH 7.0, containing 2 % mannitol.
Host: E. Coli
Purification: > 96 % HPLC analyses.
Storage conditions: Use a manual defrost freezer and avoid repeated freeze-thaw cycles.12 months from date of receipt, -20 to -70 ? as supplied.1 month, 2 to 8 ? under sterile conditions after reconstitution.3 months, -20 to -70 ? under sterile conditions after reconstitutio
Aa sequence: LTVVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPGPQSHNDGDFEEP EEYL