Recombinant Human Mediator of RNA polymerase II transcription subunit 1 (MED1), partial

Supplier: Biomatik
Reference: RPC23026
Name: Recombinant Human Mediator of RNA polymerase II transcription subunit 1 (MED1), partial
Category: Protein
Subcategory: Recombinant Protein
Research Area: Epigenetics And Nuclear Signaling
Aditional Names: Activator-recruited cofactor 205 kDa componentARC205Mediator complex subunit 1Peroxisome proliferator-activated receptor-binding proteinPBPPPAR-binding proteinThyroid hormone receptor-associated protein complex 220 kDa componentTrap220Thyroid receptor-interacting protein 2TR-interacting protein 2TRIP-2Vitamin D receptor-interacting protein complex component DRIP205p53 regulatory protein RB18A
Unit: 20ug 100ug 1mg
Conjugation: Unconjugated
Price: Consultar
Host: E. Coli
Reactivity: Human (Homo sapiens)
Storage conditions: -20°C. Avoid repeated freeze/thaw cycles.
Aa sequence: FGEEYFDESSQSGDNDDFKGFASQALNTLGVPMLGGDNGETKFKGNNQADTVDFSIISVAGKALAPADLMEHHSGSQGPLLTTGDLGKEKTQKRVKEGNGTSNSTLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPF