Recombinant Bovine coronavirus Non-structural protein of 12.7 kDa (5a)

Supplier: Biomatik
Reference: RPC28016
Name: Recombinant Bovine coronavirus Non-structural protein of 12.7 kDa (5a)
Category: Protein
Subcategory: Recombinant Protein; Coronavirus Protein
Research Area: Microbiology
Aditional Names: ns12.7; 12.7 kDa accessory protein
Unit: 20ug 100ug 1mg
Conjugation: Unconjugated
Price: Consultar
Host: Baculovirus
Reactivity: Bovine coronavirus (strain 98TXSF-110-LUN) (BCoV-L
Storage conditions: -20°C. Avoid repeated freeze/thaw cycles.
Aa sequence: MDIWKPEIKYLRYTNGFNVSELEDACFKFNYKFPKVGYCRVPSHAWCRNQGSFCATLTLYGKSKHYDKYFGVITGFTAFANTVEEAVNKLVFLAVDFITWRRQELNVHG