Recombinant Human FGF2 Protein

Supplier: Boster
Reference: R00121
Name: Recombinant Human FGF2 Protein
Category: Protein
Subcategory: Recombinant Proteins
Unit: 100?g/vial
Price: Consultar
Format: Lyophilized
Reactivity: Human
Description: Fibroblast Growth Factor basic (FGF-basic/FGF-2) is a single-chain polypeptide growth factor that plays a significant role in the process of wound healing and is a potent inducer of angiogenesis. Several different forms of the human protein exist ranging
Purification: >95%, by SDS-PAGE quantitative densitometry by Coomassie® Blue Staining.
Storage conditions: Lyophilized recombinant mouse Fibroblast Growth Factor basic (FGF-basic/FGF-2) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhFGF2 remains stable up to 2 weeks at 4°C or up to 3 months at -20°C.
Aa sequence: PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS