SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag

Supplier: Boster
Reference: RCOV03
Name: SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag
Category: Protein
Subcategory: Recombinant Proteins
Aditional Names: SARS-CoV-2, COVID-19, 2019-nCov, coronavirus, NSP9, Nonstructural Protein 9
Unit: 100?g/vial
Price: Consultar
Format: Lyophilized
Reactivity: Mouse
Description: SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag is produced in E. coli and has a theoretical molecular weight of 13.2KD. This product is for research use only. Product is under validation for additional applications and indications. If you're interested, plea
Purification: > 90%. Purification measurement method by SDS-PAGE quantitative densitometry by Coomassie® Blue Staining.
Method of purification: Nickel column affinity purification
Storage conditions: The product is shipped at ambient temperature. Upon receipt, store it immediately at -20?C for 6 months under sterile conditions. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Aa sequence: 6×His tag at C-terminal
Accession #: YP_009725305
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ