Volver

Anti-SARS-CoV-2 NSP12/RNA polymerase Antibody

Supplier: Boster
Reference: A34004
Name: Anti-SARS-CoV-2 NSP12/RNA polymerase Antibody
Category: Antibody
Subcategory: Primary Antibodies,Rabbit Polyclonal Antibodies
Aditional Names: Replicase polyprotein 1ab; pp1ab; ORF1ab polyprotein; nsp12; RNA-directed RNA polymerase; Pol; RdRp; Non-structural protein 12
Unit: 10ug 100 ?g/vial
Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 ?g/ml.
Clonality: Polyclonal
Price: Consultar
Format: Lyophilized
Immunogen: SADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTN
Host: Rabbit
Reactivity: Human
Application: ELISA
Description: Boster Bio Anti-SARS-CoV-2 NSP12/RNA polymerase Antibody catalog # A34004. Tested in ELISA applications. This antibody reacts with Human.
Isotype: Rabbit IgG
Purification: Immunogen affinity purified.
Storage conditions: Store at -20?C for one year from date of receipt. After reconstitution, at 4?C for one month. It can also be aliquotted and stored frozen at -20?C for six months. Avoid repeated freeze-thaw cycles.
Assay inforation: ELISA, 0.001-0.1?g/ml, Human
Solicitar hoja técnica Contacto