Volver

IL-13 Interleukin-13 Human Recombinant Protein

Supplier: Boster
Reference: PROTP35225
Name: IL-13 Interleukin-13 Human Recombinant Protein
Category: Protein
Subcategory: Recombinant Proteins
Aditional Names: NC30; ALRH; BHR1; P600; IL-13; MGC116786; MGC116788; MGC116789
Unit: 2ug 10ug 1mg
Price: Consultar
Format: Sterile Filtered White lyophilized (freeze-dried) powder.
Reactivity: Human
Description: Interleukin-13 Human Recombinant produced in E. coli is a single, non-glycosylated polypeptide chain containing 112 amino acids and having a molecular mass of 12 kDa. The IL-13 is purified by proprietary chromatographic techniques.
Function: Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses.
Cell localization: Secreted.
Purification: Greater than 95% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.
Storage conditions: Lyophilized Interleukin-13 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL13 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended t
Aa sequence: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVS GCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFRE GRFN
Solicitar hoja técnica Contacto