Volver

IP-10 Human Recombinant Protein (CXCL10)

Supplier: Boster
Reference: PROTP02778
Name: IP-10 Human Recombinant Protein (CXCL10)
Category: Protein
Subcategory: Recombinant Proteins
Aditional Names: Small inducible cytokine B10; CXCL10; 10 kDa; Gamma-IP10; IP-10; chemokine (C-X-C motif) ligand 10; C7; IFI10; INP10; crg-2; mob-1; SCYB10; gIP-10
Unit: 5ug 25ug 1mg
Price: Consultar
Format: Sterile Filtered White lyophilized (freeze-dried) powder.
Reactivity: Human
Description: IP-10 Human Recombinant produced in E. coli is a single, non-glycosylated, polypeptide chain containing 77 amino acids and having a molecular mass of 8.6kDa. The IP-10 is purified by proprietary chromatographic techniques.
Function: Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.
Cell localization: Secreted.
Purification: Greater than 95.0% as determined by SDS-PAGE.
Storage conditions: Lyophilized IP-10 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CXCL10 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a
Aa sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA IKNLLKAVSKERSKRSP
Solicitar hoja técnica Contacto