IL-19 Interleukin-19 Mouse Recombinant Protein

Supplier: Boster
Reference: PROTQ8CJ70
Name: IL-19 Interleukin-19 Mouse Recombinant Protein
Category: Protein
Subcategory: Recombinant Proteins
Aditional Names: Interleukin-19; IL-19; Il19
Unit: 2ug 10ug 1mg
Price: Consultar
Format: Sterile Filtered White lyophilized (freeze-dried) powder.
Reactivity: Mouse
Description: Interleukin-19 Mouse Recombinant produced in E. coli is a single, non-glycosylated polypeptide chain containing 153 amino acids and having a molecular mass of 17.7kDa. The IL-19 is purified by proprietary chromatographic techniques.
Function: May play some important roles in inflammatory responses. Up-regulates IL-6 and TNF-alpha and induces apoptosis.
Cell localization: Secreted.
Purification: Greater than 95.0% as determined by SDS-PAGE.
Storage conditions: Lyophilized Interleukin-19 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL19 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended t
Aa sequence: MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLL TFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRII HDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA