Volver

BAFF-R B-cell Activating Factor Receptor Human Recombinant Protein

Supplier: Boster
Reference: PROTQ96RJ3
Name: BAFF-R B-cell Activating Factor Receptor Human Recombinant Protein
Category: Protein
Subcategory: Recombinant Proteins
Aditional Names: TNFRSF13C; CD268; BAFF-R; MGC138235; B cell-activating factor receptor
Unit: 10ug 50ug 1mg
Price: Consultar
Format: Sterile Filtered White lyophilized (freeze-dried) powder.
Reactivity: Human
Description: B Lymphocyte Stimulator Receptor Human Recombinant extracellular produced in E. coli is a single, non-glycosylated polypeptide chain containing 76 amino acids and having a molecular mass of 7.7 kDa. The BAFF-R is purified by proprietary chromatographic te
Function: B-cell receptor specific for TNFSF13B/TALL1/BAFF/BLyS. Promotes the survival of mature B-cells and the B-cell response.
Cell localization: Membrane
Purification: Greater than 95.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.
Storage conditions: Lyophilized BAFF-R although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B Lymphocyte Stimulator Receptor should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze
Aa sequence: MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAG ASSPAPRTALQPQESVGAGAGEAALPLPG
Solicitar hoja técnica Contacto