Volver

PRL-R Prolactin Soluble Receptor Human Recombinant Protein

Supplier: Boster
Reference: PROTP16471
Name: PRL-R Prolactin Soluble Receptor Human Recombinant Protein
Category: Protein
Subcategory: Recombinant Proteins
Aditional Names: PRL-R; hPRLrI
Unit: 5ug 20ug 1mg
Price: Consultar
Format: Sterile filtered white lyophilized powder.
Reactivity: Human
Description: Extra Cellular Domain Prolactin Receptor Human Recombinant produced in E. coli is a non-glycosylated, polypeptide chain containing 210 amino acids and having a molecular mass of 23.97 kDa. The Prolactin Receptor is purified by proprietary chromatographic
Function: This is a receptor for the anterior pituitary hormone prolactin (PRL). Acts as a prosurvival factor for spermatozoa by inhibiting sperm capacitation through suppression of SRC kinase activation and stimulation of AKT. Isoform 4 is unable to transduce pro
Cell localization: Membrane
Purification: Greater than 97.0% as determined by (a) Analysis by SEC-HPLC, (b) Analysis by SDS-PAGE, and (c) Gel filtration at pH 8 under non denaturative conditions.
Storage conditions: Lyophilized PRL-R although stable at room temperature for 1-2 weeks, should be stored desiccated below -18°C or preferably even at -80°C to prevent dimer formation. Upon reconstitution PRL-R should be stored sterile at 4°C between 2-7 days and for future
Aa sequence: AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCH FGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYL WIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVR CKPDHGYWSAWSPATFIQIPSDFTMNDTTVW
Solicitar hoja técnica Contacto