Volver

FLT1-D3 Vascular Endothelial Growth Factor Receptor-1 D3 Human Recombinant Protein

Supplier: Boster
Reference: PROTP17948
Name: FLT1-D3 Vascular Endothelial Growth Factor Receptor-1 D3 Human Recombinant Protein
Category: Protein
Subcategory: Recombinant Proteins
Aditional Names: FLT-1; FLT1; Tyrosine-protein kinase receptor FLT; Flt-1; Tyrosine-protein kinase FRT; Fms-like tyrosine kinase 1; VEGFR-1
Unit: 2ug 10ug 100ug
Price: Consultar
Format: Sterile Filtered White lyophilized (freeze-dried) powder.
Reactivity: Human
Description: FLT1 D1-3 Human Recombinant produced in baculovirus is monomeric, glycosylated, polypeptide containing 327 amino acids and having a molecular mass of 45 kDa. The soluble receptor protein contains only the first 3 extracellular domains, which contain all t
Function: Tyrosine-protein kinase that acts as a cell-surface receptor for VEGFA, VEGFB and PGF, and plays an essential role in the development of embryonic vasculature, the regulation of angiogenesis, cell survival, cell migration, macrophage function, chemotaxis
Cell localization: Isoform 1: Cell membrane; Single-pass type I membrane protein. Endosome. Autophosphorylation promotes ubiquitination and endocytosis.
Purification: Greater than 90.0% as determined by SDS-PAGE.
Storage conditions: Lyophilized FLT-1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FLT1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a c
Aa sequence: SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSI TKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYI FISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDT LIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQT NTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRA
Solicitar hoja técnica Contacto