Volver

Noggin Mouse Recombinant Protein

Supplier: Boster
Reference: PROTP97466
Name: Noggin Mouse Recombinant Protein
Category: Protein
Subcategory: Recombinant Proteins
Aditional Names: Noggin; SYM1; SYNS1; NOG
Unit: 5ug 20ug 1mg
Price: Consultar
Format: Sterile Filtered White lyophilized (freeze-dried) powder.
Reactivity: Mouse
Description: Noggin Mouse Recombinant produced in E. coli is a non-glycosylated, disulfide-linked protein consisting of two 206 amino acid polypeptide chains, having a total molecular mass of approximately 46.4 kDa (each chain 23.2 kDa).
Function: Essential for cartilage morphogenesis and joint formation. Inhibitor of bone morphogenetic proteins (BMP) signaling which is required for growth and patterning of the neural tube and somite (PubMed:9585504, PubMed:9603738). Inhibits chondrocyte different
Cell localization: Secreted.
Purification: Greater than 95.0% as determined by SDS-PAGE.
Storage conditions: Lyophilized Mouse Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse Noggin should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recomme
Aa sequence: MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYD PGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKG LEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRF WPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGQR CGWIPIQYPIISECKCSC
Solicitar hoja técnica Contacto