Volver

MX1 Myxovirus Resistance 1 Bovine Recombinant Protein

Supplier: Boster
Reference: PROTP79135
Name: MX1 Myxovirus Resistance 1 Bovine Recombinant Protein
Category: Protein
Subcategory: Recombinant Proteins
Aditional Names: Interferon-induced GTP-binding protein Mx1; Myxoma resistance protein 1; Myxovirus resistance protein 1; MX1; Interferon-Induced Protein P78; IFI-78K; IFI78; MxA
Unit: 5ug 20ug 1mg
Price: Consultar
Format: Sterile Filtered White lyophilized (freeze-dried) powder.
Reactivity: Goat
Description: MX1 Bovine Recombinant fused with a 20 amino acid His tag at N-terminus produced in E. coli is a single, non-glycosylated, polypeptide chain (1-648 a.a) containing a total of 668 amino acids and having a molecular mass of 77kDa. The MX1 is purified by pro
Function: Interferon-induced dynamin-like GTPase with antiviral activity against rabies virus (RABV), vesicular stomatitis virus (VSV) and murine pneumonia virus (MPV). Isoform 1 but not isoform 2 shows antiviral activity against vesicular stomatitis virus (VSV).
Cell localization: Cytoplasm
Purification: Greater than 90.0% as determined by (a) Analysis by RP-HPLC and (b) Analysis by SDS-PAGE.
Storage conditions: Lyophilized MX1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MX1 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a car
Aa sequence: MVHSDLGIEELDSPESSLNGSEDMESKSNLYSQYEEKVRPCID LIDSLRSLGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLRLKKLGNE DEWKGKVSFLDKEIEIPDASQVEKEISEAQIAIAGEGTGISHELISLEVSSPHVPDLTLIDLP GITRVAVGNQPPDIEYQIKSLIRKYILRQETINLVVVPANVDIATTEALRMAQEVDPQGD
Solicitar hoja técnica Contacto