Volver

Met Proto-Oncogene Human Recombinant Protein

Supplier: Boster
Reference: PROTP08581
Name: Met Proto-Oncogene Human Recombinant Protein
Category: Protein
Subcategory: Recombinant Proteins
Aditional Names: Hepatocyte growth factor receptor; HGF receptor; HGF/SF receptor; Proto-oncogene c-Met; Scatter factor receptor; SF receptor; Tyrosine-protein kinase Met; MET; HGFR; AUTS9; RCCP2
Unit: 2ug 10ug 100ug
Price: Consultar
Format: Sterile Filtered clear colorless solution.
Reactivity: Human
Description: Met Proto-Oncogene Human Recombinant produced in Insect cells amino acids 1039-1345, having a molecular weight of 34.6kDa. MET is purified by proprietary chromatographic techniques.
Function: Receptor tyrosine kinase that transduces signals from the extracellular matrix into the cytoplasm by binding to hepatocyte growth factor/HGF ligand. Regulates many physiological processes including proliferation, scattering, morphogenesis and survival. L
Cell localization: Membrane; Single-pass type I membrane protein.
Purification: Greater than 90.0% as determined by SDS-PAGE.
Storage conditions: Store at 4°C if entire vial will be used within 2-4 weeks. Store frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.
Aa sequence: DSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTL LDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVL PYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDE KFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFG VLLWELMTRGAPPYPDVNT
Solicitar hoja técnica Contacto