GUCA2B Prouroguanylin Human Recombinant Protein

Supplier: Boster
Reference: PROTQ16661
Name: GUCA2B Prouroguanylin Human Recombinant Protein
Category: Protein
Subcategory: Recombinant Proteins
Aditional Names: Guanylate cyclase activator 2B; UGN; GCAP-II; GUCA2B
Unit: 2ug 10ug 1mg
Price: Consultar
Format: Sterile Filtered clear solution.
Reactivity: Human
Description: Prouroguanylin Human Recombinant is 10.7 kDa protein containing 86 amino acid residues of the human prouroguanylin and 10 additional amino acid His Tag. The Prouroguanylin is purified by proprietary chromatographic techniques.
Function: Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an aut
Cell localization: Secreted.
Purification: Greater than 95.0% as determined by SDS-PAGE.
Storage conditions: Store at 4°C if entire vial will be used within 2-4 weeks. Store frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
Aa sequence: VYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLP AVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL