CSRP2 (NM_001321) Human Recombinant Protein

Supplier: Boster
Reference: PROTQ16527
Name: CSRP2 (NM_001321) Human Recombinant Protein
Category: Protein
Subcategory: Recombinant Proteins
Unit: 20ug
Concentration: >50 ug/mL as determined by microplate BCA method
Price: Consultar
Format: Frozen Solution in PBS Buffer
Description: Recombinant protein of human cysteine and glycine-rich protein 2 (CSRP2)
Purification: > 80% as determined by SDS-PAGE and Coomassie blue staining
Storage conditions: Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Aa sequence: MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ