Volver

Recombinant Human NCAM-1/CD56 Fc Chimera Protein, Insect Cells Derived

Supplier: Signalway
Reference: AP60516
Name: Recombinant Human NCAM-1/CD56 Fc Chimera Protein, Insect Cells Derived
Category: Protein
Subcategory: Proteins with activity
Unit: 5ug 100ug 500ug
Price: Consultar
Format: Lyophilized from a 0.2 ?m filtered solution in PBS, pH 7.0, with 5 % Trehalose, 0.02 % Tween-20.
Host: Insect Cell
Purification: > 90 % by SDS-PAGE analyses.
Storage conditions: Use a manual defrost freezer and avoid repeated freeze-thaw cycles.- 12 months from date of receipt, -20 to -70 ? as supplied.- 1 month, 2 to 8 ? under sterile conditions after reconstitution.- 3 months, -20 to -70 ? under sterile conditions after reconst
Aa sequence: AGMGMLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDS
Solicitar hoja técnica Contacto