Recombinant Human CD59

Supplier: Signalway
Reference: AP60515
Name: Recombinant Human CD59
Category: Protein
Subcategory: Proteins with activity
Unit: 5ug 100ug 500ug
Price: Consultar
Format: Lyophilized from a 0.2 ?m filtered concentrated solution in PBS, pH 7.0, with 1 mM DTT, 5 % trehalose.
Host: E. Coli
Purification: > 97 % by SDS-PAGE analyses.
Storage conditions: Use a manual defrost freezer and avoid repeated freeze-thaw cycles.- 12 months from date of receipt, -20 to -70 ? as supplied.- 1 month, 2 to 8 ? under sterile conditions after reconstitution.- 3 months, -20 to -70 ? under sterile conditions after reconst
Aa sequence: LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN